"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A2S613"	"{'domain_architectures': 8425, 'entries': 4, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'hamap': 1, 'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 8425}"	"['Required for efficient ubiquinone (coenzyme Q) biosynthesis. UbiK is probably an accessory factor of Ubi enzymes and facilitates ubiquinone biosynthesis by acting as an assembly factor, a targeting factor, or both']"	"ubiK"	""	"A2S613_BURM9"	"2969ed37e6f61e3543aa1c386f98f7a18ae596c7"	True	False	False	83	"Ubiquinone biosynthesis accessory factor UbiK"	3	""	"MKQPSDVFNDLQARIGDLLKNSPAKDVERNVKAMLTQGFSKLDLVTREEFDTQAQVLARTRARLEELEKRVAELEQKLADVQS"	"unreviewed"	"{'taxId': '412022', 'scientificName': 'Burkholderia mallei (strain NCTC 10229)', 'fullName': 'Burkholderia mallei (strain NCTC 10229)'}"