HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A2S4M4",
"id": "A2S4M4_BURM9",
"source_organism": {
"taxId": "412022",
"scientificName": "Burkholderia mallei (strain NCTC 10229)",
"fullName": "Burkholderia mallei (strain NCTC 10229)"
},
"name": "Dihydrofolate reductase",
"description": [
"Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis"
],
"length": 167,
"sequence": "MTTLTLIVARARNGVIGRDNRLPWKLPEDLAFFKRTTMGAPIVMGRKTHESIGRPLPGRRNIVVTRDAARRFDGCDTVTSLDDALALAARDGAAEAFLIGGAQLYEEGLRHADKLIVTEIDQDFEGDASFPAPDPAQWEAVSRDAHRAAQPNDFTYAFVVYRRRRAG",
"proteome": null,
"gene": "folA",
"go_terms": [
{
"identifier": "GO:0004146",
"name": "dihydrofolate reductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046654",
"name": "tetrahydrofolate biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "18e639bb52cd0649ef370776485d30568df413de",
"counters": {
"domain_architectures": 27639,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 27639
}
}
}