GET /api/protein/UniProt/A2S4M4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A2S4M4",
        "id": "A2S4M4_BURM9",
        "source_organism": {
            "taxId": "412022",
            "scientificName": "Burkholderia mallei (strain NCTC 10229)",
            "fullName": "Burkholderia mallei (strain NCTC 10229)"
        },
        "name": "Dihydrofolate reductase",
        "description": [
            "Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis"
        ],
        "length": 167,
        "sequence": "MTTLTLIVARARNGVIGRDNRLPWKLPEDLAFFKRTTMGAPIVMGRKTHESIGRPLPGRRNIVVTRDAARRFDGCDTVTSLDDALALAARDGAAEAFLIGGAQLYEEGLRHADKLIVTEIDQDFEGDASFPAPDPAQWEAVSRDAHRAAQPNDFTYAFVVYRRRRAG",
        "proteome": null,
        "gene": "folA",
        "go_terms": [
            {
                "identifier": "GO:0004146",
                "name": "dihydrofolate reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046654",
                "name": "tetrahydrofolate biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "18e639bb52cd0649ef370776485d30568df413de",
        "counters": {
            "domain_architectures": 27639,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 27639
        }
    }
}