"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A2S4M4"	"{'domain_architectures': 27639, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'pirsf': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 27639}"	"['Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis']"	"folA"	"[{'identifier': 'GO:0004146', 'name': 'dihydrofolate reductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0046654', 'name': 'tetrahydrofolate biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0050661', 'name': 'NADP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A2S4M4_BURM9"	"18e639bb52cd0649ef370776485d30568df413de"	True	False	False	167	"Dihydrofolate reductase"	3	""	"MTTLTLIVARARNGVIGRDNRLPWKLPEDLAFFKRTTMGAPIVMGRKTHESIGRPLPGRRNIVVTRDAARRFDGCDTVTSLDDALALAARDGAAEAFLIGGAQLYEEGLRHADKLIVTEIDQDFEGDASFPAPDPAQWEAVSRDAHRAAQPNDFTYAFVVYRRRRAG"	"unreviewed"	"{'taxId': '412022', 'scientificName': 'Burkholderia mallei (strain NCTC 10229)', 'fullName': 'Burkholderia mallei (strain NCTC 10229)'}"