HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A1KWM5",
"id": "A1KWM5_NEIMF",
"source_organism": {
"taxId": "272831",
"scientificName": "Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)",
"fullName": "Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)"
},
"name": "Glyceraldehyde-3-phosphate dehydrogenase",
"description": [
"Could be involved in carbon fixation as a component of the Calvin cycle. Catalyzes the oxidative phosphorylation of glyceraldehyde 3-phosphate (G3P) to 1,3-bisphosphoglycerate (BPG) using the cofactor NAD. The first reaction step involves the formation of a hemiacetal intermediate between G3P and a cysteine residue, and this hemiacetal intermediate is then oxidized to a thioester, with concomitant reduction of NAD to NADH. The reduced NADH is then exchanged with the second NAD, and the thioester is attacked by a nucleophilic inorganic phosphate to produce BPG"
],
"length": 345,
"sequence": "MKFRFTAWSIYMSIKVAINGFGRIGRLALRQIEKAHDIEVVAVNDLTPAEMLLHLFKYDSTQGRFQGTAELKDDAIVVNGKEIKVFANPNPEELPWGELGVDVVLECTGFFTNKTKAEAHIRAGARKVVISAPSGNDVKTVVYGVNQDILDGSETVISAASCTTNCLAPMAAVLQKEFGVVEGLMTTIHAYTGDQNTLDAPHRKGDLRRARAAALNIVPNSTGAAKAIGLVIPELNGKLDGSAQRVPVATGSLTELVSVLERPVTKEEINAAMKAAASESYGYNEDQIVSSDVVGIEYGSLFDATQTRVMTVGGKQLVKTVAWYDNEMSYTCQLVRTLEYFAGKI",
"proteome": null,
"gene": "NMC2137",
"go_terms": [
{
"identifier": "GO:0051287",
"name": "NAD binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016620",
"name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006006",
"name": "glucose metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "86e234e29d479086cc42dd5d3ba81d154e67c69b",
"counters": {
"domain_architectures": 60723,
"entries": 20,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cdd": 2,
"smart": 1,
"ssf": 2,
"cathgene3d": 2,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"prints": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 60723
}
}
}