"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A1KWM5"	"{'domain_architectures': 60723, 'entries': 20, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'cdd': 2, 'smart': 1, 'ssf': 2, 'cathgene3d': 2, 'pirsf': 1, 'panther': 1, 'ncbifam': 1, 'prints': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 60723}"	"['Could be involved in carbon fixation as a component of the Calvin cycle. Catalyzes the oxidative phosphorylation of glyceraldehyde 3-phosphate (G3P) to 1,3-bisphosphoglycerate (BPG) using the cofactor NAD. The first reaction step involves the formation of a hemiacetal intermediate between G3P and a cysteine residue, and this hemiacetal intermediate is then oxidized to a thioester, with concomitant reduction of NAD to NADH. The reduced NADH is then exchanged with the second NAD, and the thioester is attacked by a nucleophilic inorganic phosphate to produce BPG']"	"NMC2137"	"[{'identifier': 'GO:0051287', 'name': 'NAD binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016620', 'name': 'oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0050661', 'name': 'NADP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006006', 'name': 'glucose metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A1KWM5_NEIMF"	"86e234e29d479086cc42dd5d3ba81d154e67c69b"	True	False	False	345	"Glyceraldehyde-3-phosphate dehydrogenase"	3	""	"MKFRFTAWSIYMSIKVAINGFGRIGRLALRQIEKAHDIEVVAVNDLTPAEMLLHLFKYDSTQGRFQGTAELKDDAIVVNGKEIKVFANPNPEELPWGELGVDVVLECTGFFTNKTKAEAHIRAGARKVVISAPSGNDVKTVVYGVNQDILDGSETVISAASCTTNCLAPMAAVLQKEFGVVEGLMTTIHAYTGDQNTLDAPHRKGDLRRARAAALNIVPNSTGAAKAIGLVIPELNGKLDGSAQRVPVATGSLTELVSVLERPVTKEEINAAMKAAASESYGYNEDQIVSSDVVGIEYGSLFDATQTRVMTVGGKQLVKTVAWYDNEMSYTCQLVRTLEYFAGKI"	"unreviewed"	"{'taxId': '272831', 'scientificName': 'Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)', 'fullName': 'Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)'}"
