General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1JME2",
        "id": "LPOB_YERE8",
        "source_organism": {
            "taxId": "393305",
            "scientificName": "Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)",
            "fullName": "Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)"
        },
        "name": "Penicillin-binding protein activator LpoB",
        "description": [
            "Regulator of peptidoglycan synthesis that is essential for the function of penicillin-binding protein 1B (PBP1b)"
        ],
        "length": 193,
        "sequence": "MKRYLSVALAALVLTGCITQPPVEPTTPPVTIEPVTPPVPETPPPVDNVPPPPKMEQSIDWAASVEPLVAQMVNSNDVANGSILLLDSVKNNTNGRLPTAKATSALHQVLSSNKKFVLISPQQLAVAKQTLGLSEEDSLGSRSKAIGLARYVSAQYVLYSDVSGDVKSPTIEMQLMQAQTGEIIWSGNGPVKR",
        "proteome": null,
        "gene": "lpoB",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c37c10180a22af5055609a9f64d9e7784ee1fd22",
        "counters": {
            "domain_architectures": 88,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "profile": 1,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 88
        }
    }
}