"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A1JME2"	"{'domain_architectures': 88, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'profile': 1, 'cathgene3d': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 88}"	"['Regulator of peptidoglycan synthesis that is essential for the function of penicillin-binding protein 1B (PBP1b)']"	"lpoB"	""	"LPOB_YERE8"	"c37c10180a22af5055609a9f64d9e7784ee1fd22"	True	False	False	193	"Penicillin-binding protein activator LpoB"	3	""	"MKRYLSVALAALVLTGCITQPPVEPTTPPVTIEPVTPPVPETPPPVDNVPPPPKMEQSIDWAASVEPLVAQMVNSNDVANGSILLLDSVKNNTNGRLPTAKATSALHQVLSSNKKFVLISPQQLAVAKQTLGLSEEDSLGSRSKAIGLARYVSAQYVLYSDVSGDVKSPTIEMQLMQAQTGEIIWSGNGPVKR"	"reviewed"	"{'taxId': '393305', 'scientificName': 'Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)', 'fullName': 'Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)'}"