General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1IIX5",
        "id": "GRAD_RHIS5",
        "source_organism": {
            "taxId": "267998",
            "scientificName": "Rhizobium sp. (strain MTP-10005)",
            "fullName": "Rhizobium sp. (strain MTP-10005)"
        },
        "name": "FADH(2)-dependent resorcinol hydroxylase, reductase component",
        "description": [
            "Involved in the gamma-resorcylate (2,6-dihydroxybenzoate) catabolism (PubMed:17158677). Reductase component of the resorcinol hydroxylase, which catalyzes the FADPH-dependent conversion of resorcinol to hydroxyquinol (PubMed:17158677). Catalyzes the reduction of FAD by NADH. The reduced flavin is then transferred to the oxygenase component GraA (PubMed:17158677)"
        ],
        "length": 179,
        "sequence": "MTSALFGLNNLAPEGVGQNFRTTMRRFPATVTVITACATGDQRDHGMTVTAVTSVSMEPPSLLVCLNNRTFLHELLLCRPDFIVNVLTQDQIALSDAFSGKVSPEERFRNGEWQRHDNGVLYLPTAHAAIACRRVAAMPYGTHTVFIGQVVSADVSETTRPLLYENAQYCAASPAGLSA",
        "proteome": null,
        "gene": "graD",
        "go_terms": [
            {
                "identifier": "GO:0010181",
                "name": "FMN binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "99d29f89f917a11644ac2fc4bedf5a173bd13b02",
        "counters": {
            "domain_architectures": 63683,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 63683
        }
    }
}