"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A1IIX5"	"{'domain_architectures': 63683, 'entries': 8, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 63683}"	"['Involved in the gamma-resorcylate (2,6-dihydroxybenzoate) catabolism (PubMed:17158677). Reductase component of the resorcinol hydroxylase, which catalyzes the FADPH-dependent conversion of resorcinol to hydroxyquinol (PubMed:17158677). Catalyzes the reduction of FAD by NADH. The reduced flavin is then transferred to the oxygenase component GraA (PubMed:17158677)']"	"graD"	"[{'identifier': 'GO:0010181', 'name': 'FMN binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"GRAD_RHIS5"	"99d29f89f917a11644ac2fc4bedf5a173bd13b02"	True	False	False	179	"FADH(2)-dependent resorcinol hydroxylase, reductase component"	1	""	"MTSALFGLNNLAPEGVGQNFRTTMRRFPATVTVITACATGDQRDHGMTVTAVTSVSMEPPSLLVCLNNRTFLHELLLCRPDFIVNVLTQDQIALSDAFSGKVSPEERFRNGEWQRHDNGVLYLPTAHAAIACRRVAAMPYGTHTVFIGQVVSADVSETTRPLLYENAQYCAASPAGLSA"	"reviewed"	"{'taxId': '267998', 'scientificName': 'Rhizobium sp. (strain MTP-10005)', 'fullName': 'Rhizobium sp. (strain MTP-10005)'}"
