GET /api/protein/UniProt/A1A7E2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A1A7E2",
"id": "SECM_ECOK1",
"source_organism": {
"taxId": "405955",
"scientificName": "Escherichia coli O1:K1 / APEC",
"fullName": "Escherichia coli O1:K1 / APEC"
},
"name": "Secretion monitor",
"description": [
"Regulates secA expression by translational coupling of the secM secA operon. Translational pausing at a specific Pro residue 5 residues before the end of the protein may allow disruption of a mRNA repressor helix that normally suppresses secA translation initiation"
],
"length": 170,
"sequence": "MSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALSNAAEPNAPAKATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPVAEESLPLQAQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISQAQGIRAGPQRLS",
"proteome": "UP000008216",
"gene": "secM",
"go_terms": [
{
"identifier": "GO:0045182",
"name": "translation regulator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7522f82e3a8c6faaa65831a0d542c312b8348e44",
"counters": {
"domain_architectures": 1393,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pirsf": 1,
"hamap": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1393
}
}
}