"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A1A7E2"	"{'domain_architectures': 1393, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pirsf': 1, 'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1393}"	"['Regulates secA expression by translational coupling of the secM secA operon. Translational pausing at a specific Pro residue 5 residues before the end of the protein may allow disruption of a mRNA repressor helix that normally suppresses secA translation initiation']"	"secM"	"[{'identifier': 'GO:0045182', 'name': 'translation regulator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"SECM_ECOK1"	"7522f82e3a8c6faaa65831a0d542c312b8348e44"	True	False	False	170	"Secretion monitor"	3	"UP000008216"	"MSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALSNAAEPNAPAKATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPVAEESLPLQAQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISQAQGIRAGPQRLS"	"reviewed"	"{'taxId': '405955', 'scientificName': 'Escherichia coli O1:K1 / APEC', 'fullName': 'Escherichia coli O1:K1 / APEC'}"