General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0C6C2",
        "id": "A0C6C2_PARTE",
        "source_organism": {
            "taxId": "5888",
            "scientificName": "Paramecium tetraurelia",
            "fullName": "Paramecium tetraurelia"
        },
        "name": "Alpha-tubulin N-acetyltransferase",
        "description": [
            "Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Promotes microtubule destabilization and accelerates microtubule dynamics; this activity may be independent of acetylation activity. Acetylates alpha-tubulin with a slow enzymatic rate, due to a catalytic site that is not optimized for acetyl transfer. Enters the microtubule through each end and diffuses quickly throughout the lumen of microtubules. Acetylates only long/old microtubules because of its slow acetylation rate since it does not have time to act on dynamically unstable microtubules before the enzyme is released"
        ],
        "length": 249,
        "sequence": "MQFQFPLQKALQTSQNGISVISASNSRRNCYLDEVIDRMGEASAIAQQLKQIITTASKFYGSDQRIYLKADGKNCLGLLKVGKKNLFYRDYSGSIKEMQPLCVLDFYVHESVQRMGVGKELFEEMLKSEQIKPEKLAYDRPSQKLIGFLNKHYNLNQYVPQNNNFVIFNQYFGQGTQPIAQGRSQKYSRNSQIDQLDIMVQQISQNKTNQQQLPQQKLGYQMSTPWAIDNHTNIYNNINSQRTNVYKIN",
        "proteome": "UP000000600",
        "gene": "GSPATT00035468001",
        "go_terms": [
            {
                "identifier": "GO:0019799",
                "name": "tubulin N-acetyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071929",
                "name": "alpha-tubulin acetylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005874",
                "name": "microtubule",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3182cc5513ab4ebda09a8a0b7d1f84fc8921bed1",
        "counters": {
            "domain_architectures": 2663,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2663
        }
    }
}