"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0C6C2"	"{'domain_architectures': 2663, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'hamap': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2663}"	"[""Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Promotes microtubule destabilization and accelerates microtubule dynamics; this activity may be independent of acetylation activity. Acetylates alpha-tubulin with a slow enzymatic rate, due to a catalytic site that is not optimized for acetyl transfer. Enters the microtubule through each end and diffuses quickly throughout the lumen of microtubules. Acetylates only long/old microtubules because of its slow acetylation rate since it does not have time to act on dynamically unstable microtubules before the enzyme is released""]"	"GSPATT00035468001"	"[{'identifier': 'GO:0019799', 'name': 'tubulin N-acetyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0071929', 'name': 'alpha-tubulin acetylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005874', 'name': 'microtubule', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0C6C2_PARTE"	"3182cc5513ab4ebda09a8a0b7d1f84fc8921bed1"	True	False	False	249	"Alpha-tubulin N-acetyltransferase"	3	"UP000000600"	"MQFQFPLQKALQTSQNGISVISASNSRRNCYLDEVIDRMGEASAIAQQLKQIITTASKFYGSDQRIYLKADGKNCLGLLKVGKKNLFYRDYSGSIKEMQPLCVLDFYVHESVQRMGVGKELFEEMLKSEQIKPEKLAYDRPSQKLIGFLNKHYNLNQYVPQNNNFVIFNQYFGQGTQPIAQGRSQKYSRNSQIDQLDIMVQQISQNKTNQQQLPQQKLGYQMSTPWAIDNHTNIYNNINSQRTNVYKIN"	"unreviewed"	"{'taxId': '5888', 'scientificName': 'Paramecium tetraurelia', 'fullName': 'Paramecium tetraurelia'}"