General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0B6X8",
        "id": "NIKR_METTP",
        "source_organism": {
            "taxId": "349307",
            "scientificName": "Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)",
            "fullName": "Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)"
        },
        "name": "Putative nickel-responsive regulator",
        "description": [
            "Transcriptional regulator"
        ],
        "length": 140,
        "sequence": "MEQELMRIGVSLPEKLLSRFDEIISQRGYSSRSEGIRDAIRNYIIHYEWMSDVEGERVGVITIVYSHHQRGLVDSLTDIQHEFGSIINSSLHVHLDKDNCLEVVILRGEGKDVRRAAERMMALKGVKHVKLTTTSVGAEL",
        "proteome": "UP000000674",
        "gene": "Mthe_0662",
        "go_terms": [
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016151",
                "name": "nickel cation binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010045",
                "name": "response to nickel cation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "170ea852c654961e4d83dfb7875fa2ce03ed6b26",
        "counters": {
            "domain_architectures": 3705,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "ncbifam": 4,
                "panther": 1,
                "hamap": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3705
        }
    }
}