"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0B6X8"	"{'domain_architectures': 3705, 'entries': 21, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'pfam': 2, 'cathgene3d': 2, 'cdd': 1, 'ncbifam': 4, 'panther': 1, 'hamap': 1, 'interpro': 8}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3705}"	"['Transcriptional regulator']"	"Mthe_0662"	"[{'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016151', 'name': 'nickel cation binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0010045', 'name': 'response to nickel cation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"NIKR_METTP"	"170ea852c654961e4d83dfb7875fa2ce03ed6b26"	True	False	False	140	"Putative nickel-responsive regulator"	3	"UP000000674"	"MEQELMRIGVSLPEKLLSRFDEIISQRGYSSRSEGIRDAIRNYIIHYEWMSDVEGERVGVITIVYSHHQRGLVDSLTDIQHEFGSIINSSLHVHLDKDNCLEVVILRGEGKDVRRAAERMMALKGVKHVKLTTTSVGAEL"	"reviewed"	"{'taxId': '349307', 'scientificName': 'Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)', 'fullName': 'Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)'}"