General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AB72ZFD7",
        "id": "A0AB72ZFD7_YERPE",
        "source_organism": {
            "taxId": "992134",
            "scientificName": "Yersinia pestis PY-08",
            "fullName": "Yersinia pestis PY-08"
        },
        "name": "Sigma factor-binding protein Crl",
        "description": [
            "Binds to the sigma-S subunit of RNA polymerase, activating expression of sigma-S-regulated genes. Stimulates RNA polymerase holoenzyme formation and may bind to several other sigma factors, such as sigma-70 and sigma-32"
        ],
        "length": 133,
        "sequence": "MTLTSAHPKSKLMKRFAALGPYLREGQCQNDHFFFDCLAVCINVKLAPEKREFWGWWIELEPSAGRFTYVYQLGLFNKEGNWNAEKISDPEVQDKLESTLRSFHLRLEEMLASIDMKLEPAADFNDQPVKLSA",
        "proteome": null,
        "gene": "crl",
        "go_terms": [
            {
                "identifier": "GO:0045893",
                "name": "positive regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "81405ee6b3c86e850112ed67bdd476b9570531b2",
        "counters": {
            "domain_architectures": 1582,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1582
        }
    }
}