"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AB72ZFD7"	"{'domain_architectures': 1582, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ncbifam': 1, 'hamap': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 1582}"	"['Binds to the sigma-S subunit of RNA polymerase, activating expression of sigma-S-regulated genes. Stimulates RNA polymerase holoenzyme formation and may bind to several other sigma factors, such as sigma-70 and sigma-32']"	"crl"	"[{'identifier': 'GO:0045893', 'name': 'positive regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0AB72ZFD7_YERPE"	"81405ee6b3c86e850112ed67bdd476b9570531b2"	True	False	False	133	"Sigma factor-binding protein Crl"	3	""	"MTLTSAHPKSKLMKRFAALGPYLREGQCQNDHFFFDCLAVCINVKLAPEKREFWGWWIELEPSAGRFTYVYQLGLFNKEGNWNAEKISDPEVQDKLESTLRSFHLRLEEMLASIDMKLEPAADFNDQPVKLSA"	"unreviewed"	"{'taxId': '992134', 'scientificName': 'Yersinia pestis PY-08', 'fullName': 'Yersinia pestis PY-08'}"