GET /api/protein/UniProt/A0AB36PIK2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AB36PIK2",
        "id": "A0AB36PIK2_SHIFL",
        "source_organism": {
            "taxId": "198214",
            "scientificName": "Shigella flexneri 2a str. 301",
            "fullName": "Shigella flexneri 2a str. 301"
        },
        "name": "Sulfurtransferase TusD",
        "description": [
            "Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions. Accepts sulfur from TusA and transfers it in turn to TusE"
        ],
        "length": 128,
        "sequence": "MRFAIVVTGPAYGTQQASSAFQFAQALIAEGHKLSSVFFYREGVYNANQLTSPASDEFDLVRGWQQLNAQHGVALNICVAAALRRGIVDETEAGRLGLASSNLQPGFTLSGLGALAEASLTCDRVVQF",
        "proteome": null,
        "gene": "tusD",
        "go_terms": [
            {
                "identifier": "GO:0016783",
                "name": "sulfurtransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008033",
                "name": "tRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ae61ece5c60d77230cda5f5370a59313a2ae0de4",
        "counters": {
            "domain_architectures": 21206,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 2,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 21206
        }
    }
}