"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AB36PIK2"	"{'domain_architectures': 21206, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 2, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 21206}"	"['Part of a sulfur-relay system required for 2-thiolation of 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) at tRNA wobble positions. Accepts sulfur from TusA and transfers it in turn to TusE']"	"tusD"	"[{'identifier': 'GO:0016783', 'name': 'sulfurtransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008033', 'name': 'tRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0AB36PIK2_SHIFL"	"ae61ece5c60d77230cda5f5370a59313a2ae0de4"	True	False	False	128	"Sulfurtransferase TusD"	3	""	"MRFAIVVTGPAYGTQQASSAFQFAQALIAEGHKLSSVFFYREGVYNANQLTSPASDEFDLVRGWQQLNAQHGVALNICVAAALRRGIVDETEAGRLGLASSNLQPGFTLSGLGALAEASLTCDRVVQF"	"unreviewed"	"{'taxId': '198214', 'scientificName': 'Shigella flexneri 2a str. 301', 'fullName': 'Shigella flexneri 2a str. 301'}"