General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AB34GVB9",
        "id": "A0AB34GVB9_ESCRO",
        "source_organism": {
            "taxId": "9764",
            "scientificName": "Eschrichtius robustus",
            "fullName": "Eschrichtius robustus (California gray whale)"
        },
        "name": "Cytosolic arginine sensor for mTORC1 subunit 1",
        "description": [
            "Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway"
        ],
        "length": 329,
        "sequence": "MELHILEHRVRVLSLARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVARDDSSNGFPRAQHGPSPTVHPIQSPENRFCVLTLDPETLPAIATTLIDVLFYSHSPPKEAASGGPGSSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIKVLQHRQEGLGS",
        "proteome": "UP001159641",
        "gene": "J1605_009905",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "86e2f292e9d15d90cb6253b7ab58cc4daf0a1d43",
        "counters": {
            "domain_architectures": 1330,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 3,
                "ssf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1330
        }
    }
}