"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AB34GVB9"	"{'domain_architectures': 1330, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 3, 'ssf': 1, 'panther': 1, 'prints': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1330}"	"['Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway']"	"J1605_009905"	""	"A0AB34GVB9_ESCRO"	"86e2f292e9d15d90cb6253b7ab58cc4daf0a1d43"	True	False	False	329	"Cytosolic arginine sensor for mTORC1 subunit 1"	3	"UP001159641"	"MELHILEHRVRVLSLARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVARDDSSNGFPRAQHGPSPTVHPIQSPENRFCVLTLDPETLPAIATTLIDVLFYSHSPPKEAASGGPGSSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIKVLQHRQEGLGS"	"unreviewed"	"{'taxId': '9764', 'scientificName': 'Eschrichtius robustus', 'fullName': 'Eschrichtius robustus (California gray whale)'}"