General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAA9TNG3",
        "id": "A0AAA9TNG3_BOVIN",
        "source_organism": {
            "taxId": "9913",
            "scientificName": "Bos taurus",
            "fullName": "Bos taurus (Bovine)"
        },
        "name": "Signal recognition particle 19 kDa protein",
        "description": [
            "Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER). Binds directly to 7SL RNA. Mediates binding of SRP54 to the SRP complex"
        ],
        "length": 120,
        "sequence": "MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKKNKMYSREWNRDLQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGGDQSLQQGEGSKKGKGKKKK",
        "proteome": "UP000009136",
        "gene": "SRP19",
        "go_terms": [
            {
                "identifier": "GO:0008312",
                "name": "7S RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006614",
                "name": "SRP-dependent cotranslational protein targeting to membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0048500",
                "name": "signal recognition particle",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "065cbf1865930c6b5debef193c5447e5354d6d66",
        "counters": {
            "domain_architectures": 93,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 93
        }
    }
}