"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AAA9TNG3"	"{'domain_architectures': 90, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 90}"	"['Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER). Binds directly to 7SL RNA. Mediates binding of SRP54 to the SRP complex']"	"SRP19"	"[{'identifier': 'GO:0008312', 'name': '7S RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006614', 'name': 'SRP-dependent cotranslational protein targeting to membrane', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0048500', 'name': 'signal recognition particle', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0AAA9TNG3_BOVIN"	"065cbf1865930c6b5debef193c5447e5354d6d66"	True	False	120	"Signal recognition particle 19 kDa protein"	3	"UP000009136"	"MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKKNKMYSREWNRDLQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGGDQSLQQGEGSKKGKGKKKK"	"unreviewed"	"{'taxId': '9913', 'scientificName': 'Bos taurus', 'fullName': 'Bos taurus (Bovine)'}"