General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAA9T1Q1",
        "id": "A0AAA9T1Q1_BOVIN",
        "source_organism": {
            "taxId": "9913",
            "scientificName": "Bos taurus",
            "fullName": "Bos taurus (Bovine)"
        },
        "name": "Biliverdin reductase A",
        "description": [
            "Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IXalpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor. Does not reduce bilirubin IXbeta. Uses the reactants NADH or NADPH depending on the pH; NADH is used at the acidic pH range (6-6.9) and NADPH at the alkaline range (8.5-8.7). NADPH, however, is the probable reactant in biological systems"
        ],
        "length": 320,
        "sequence": "MCCLAYFRPEATLFCKELLQKETKMNTEPERKFGVVVVGVGRAGSVRMRDLRNPHASSAFLNLIGFVSRRELGSIDEVPQISLEDALSSQEVEVAFICSESSSHEDYIRQFLNAGKHVLVEYPMTLSWVAAKDLWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAAPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETENKSPLTWIEEKAPGLKRNRRLSFHFRSGSLENMPNVGINKNIFLKDQNIFVQKLLGQFSEEELAAEKKRILHCLWLAGEIQKHCCSKQ",
        "proteome": "UP000009136",
        "gene": "BLVRA",
        "go_terms": [
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004074",
                "name": "biliverdin reductase [NAD(P)H] activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042167",
                "name": "heme catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "807cb7f491ce4525417f61aaec49006ab219d444",
        "counters": {
            "domain_architectures": 998,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 2,
                "cathgene3d": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 998
        }
    }
}