"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AAA9T1Q1"	"{'domain_architectures': 935, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'ssf': 2, 'cathgene3d': 2, 'pirsf': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 935}"	"['Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IXalpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor. Does not reduce bilirubin IXbeta. Uses the reactants NADH or NADPH depending on the pH; NADH is used at the acidic pH range (6-6.9) and NADPH at the alkaline range (8.5-8.7). NADPH, however, is the probable reactant in biological systems']"	"BLVRA"	"[{'identifier': 'GO:0000166', 'name': 'nucleotide binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004074', 'name': 'biliverdin reductase [NAD(P)H] activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0042167', 'name': 'heme catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0AAA9T1Q1_BOVIN"	"807cb7f491ce4525417f61aaec49006ab219d444"	True	False	320	"Biliverdin reductase A"	3	"UP000009136"	"MCCLAYFRPEATLFCKELLQKETKMNTEPERKFGVVVVGVGRAGSVRMRDLRNPHASSAFLNLIGFVSRRELGSIDEVPQISLEDALSSQEVEVAFICSESSSHEDYIRQFLNAGKHVLVEYPMTLSWVAAKDLWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAAPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETENKSPLTWIEEKAPGLKRNRRLSFHFRSGSLENMPNVGINKNIFLKDQNIFVQKLLGQFSEEELAAEKKRILHCLWLAGEIQKHCCSKQ"	"unreviewed"	"{'taxId': '9913', 'scientificName': 'Bos taurus', 'fullName': 'Bos taurus (Bovine)'}"