HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA97KBM8",
"id": "A0AA97KBM8_EUBMA",
"source_organism": {
"taxId": "481883",
"scientificName": "Eublepharis macularius",
"fullName": "Eublepharis macularius (Leopard gecko)"
},
"name": "Type-2 angiotensin II receptor",
"description": [
"Receptor for angiotensin II, a vasoconstricting peptide. Signals primarily via a non-canonical G-protein- and beta-arrestin independent pathways. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation"
],
"length": 375,
"sequence": "MHASNYSTVIATEQMLEESYLSPTNVSSLSHCSVNLSSYQFVLIPVLYCILFIFGLVGNSLVIAVLCRQKNPKTVANVYIVNLAVADLLALVTVPFWASYYAYGYNWLFGSVMCKLSSSVFGLTMFASIFFITCMSMDRYQAIAHPFQSQRRTLQQASVTALLVWGLAALTSLPAFYFRDTQYIEDLNVTACVMAFPNETYSEWSAGTALMKNTLGFLIPVAIIATCYIWIRVHLMKARGLEKNKQKRDRVLKVVAAVVVAFLICWLPFHILTFLDALTWMHVIKECWIVSAIDMALPFGISMGFANSCINPLLYYFIGNQFQDKLHLFKLRLYQFNSNRQGFLSSKSSSLKDTDILKDAKHREGDSGVMQTHPL",
"proteome": "UP001190640",
"gene": "AGTR2",
"go_terms": [
{
"identifier": "GO:0004930",
"name": "G protein-coupled receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007186",
"name": "G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004945",
"name": "angiotensin type II receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006954",
"name": "inflammatory response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042981",
"name": "regulation of apoptotic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0097746",
"name": "blood vessel diameter maintenance",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
"counters": {
"domain_architectures": 394800,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"smart": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"prints": 3,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 394800
}
}
}