GET /api/protein/UniProt/A0AA97KA30/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA97KA30",
"id": "A0AA97KA30_EUBMA",
"source_organism": {
"taxId": "481883",
"scientificName": "Eublepharis macularius",
"fullName": "Eublepharis macularius (Leopard gecko)"
},
"name": "Motile sperm domain-containing protein 1",
"description": [
"Plays a role in differentiation and/or proliferation of mesenchymal stem cells. Proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, another study suggests that it is not required for EMT or stem cell self-renewal and acts during later stages of differentiation"
],
"length": 214,
"sequence": "MQQQKRQPELVEGNLPVFVFPTELLFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDIRPCHYGVIDKFRLQVSEQSQRKALGRKEVIAMLLPTAKEQQKEEEEKRIKEHLTESVFFEQTLCQPEHRIASSGPSLLTVFLGIVCIAALMLPTLGEVDSLVPLYLHLSVNQKLVAAYVLGLITMVILRT",
"proteome": "UP001190640",
"gene": "MOSPD1",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "15912120c884367a05ea3e431a6fdf0c2c4e326a",
"counters": {
"domain_architectures": 18780,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"profile": 1,
"pfam": 1,
"cathgene3d": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 18780
}
}
}