"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AA97KA30"	"{'domain_architectures': 18780, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'profile': 1, 'pfam': 1, 'cathgene3d': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 18780}"	"['Plays a role in differentiation and/or proliferation of mesenchymal stem cells. Proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, another study suggests that it is not required for EMT or stem cell self-renewal and acts during later stages of differentiation']"	"MOSPD1"	""	"A0AA97KA30_EUBMA"	"15912120c884367a05ea3e431a6fdf0c2c4e326a"	True	False	False	214	"Motile sperm domain-containing protein 1"	4	"UP001190640"	"MQQQKRQPELVEGNLPVFVFPTELLFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDIRPCHYGVIDKFRLQVSEQSQRKALGRKEVIAMLLPTAKEQQKEEEEKRIKEHLTESVFFEQTLCQPEHRIASSGPSLLTVFLGIVCIAALMLPTLGEVDSLVPLYLHLSVNQKLVAAYVLGLITMVILRT"	"unreviewed"	"{'taxId': '481883', 'scientificName': 'Eublepharis macularius', 'fullName': 'Eublepharis macularius (Leopard gecko)'}"