HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA96VC55",
"id": "A0AA96VC55_9STRE",
"source_organism": {
"taxId": "3028082",
"scientificName": "Streptococcus suivaginalis",
"fullName": "Streptococcus suivaginalis"
},
"name": "D-aminoacyl-tRNA deacylase",
"description": [
"An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality"
],
"length": 147,
"sequence": "MKIVLQRVSQASVTIEGSIHGQIEQGLLLLVGVGPDDSQEDLDYAVRKIVNMRIFSDEAGKMNKSVQDVAGKILSISQFTLFADTKKGNRPAFTGAAAPALASQLYDAFNQALSAFVPVEVGVFGADMAVSLVNDGPVTIVLDTKNR",
"proteome": "UP001304088",
"gene": "dtd",
"go_terms": [
{
"identifier": "GO:0002161",
"name": "aminoacyl-tRNA deacylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051499",
"name": "D-aminoacyl-tRNA deacylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f5be7e64ef081c09c5a2f79246df4a2ddc956ba1",
"counters": {
"domain_architectures": 25258,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 25258
}
}
}