"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AA96VC55"	"{'domain_architectures': 25258, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 25258}"	"['An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality']"	"dtd"	"[{'identifier': 'GO:0002161', 'name': 'aminoacyl-tRNA deacylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051499', 'name': 'D-aminoacyl-tRNA deacylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0AA96VC55_9STRE"	"f5be7e64ef081c09c5a2f79246df4a2ddc956ba1"	True	False	False	147	"D-aminoacyl-tRNA deacylase"	3	"UP001304088"	"MKIVLQRVSQASVTIEGSIHGQIEQGLLLLVGVGPDDSQEDLDYAVRKIVNMRIFSDEAGKMNKSVQDVAGKILSISQFTLFADTKKGNRPAFTGAAAPALASQLYDAFNQALSAFVPVEVGVFGADMAVSLVNDGPVTIVLDTKNR"	"unreviewed"	"{'taxId': '3028082', 'scientificName': 'Streptococcus suivaginalis', 'fullName': 'Streptococcus suivaginalis'}"