General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AA50UXM4",
        "id": "A0AA50UXM4_9NEOP",
        "source_organism": {
            "taxId": "2201707",
            "scientificName": "Cupitha purreea",
            "fullName": "Cupitha purreea"
        },
        "name": "Protein hedgehog",
        "description": [
            "The C-terminal part of the hedgehog protein precursor displays an autoproteolysis activity that results in the cleavage of the full-length protein into two parts (N-product and C-product). In addition, the C-terminal part displays a cholesterol transferase activity that results by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product. Once cleaved, the C-product has no signaling activity and diffuses from the cell"
        ],
        "length": 87,
        "sequence": "QRCKEKLNTLAISVMNQWPGVRLRVIEGWDEENSHQDQLHYEGRAVDVTTSDRDRSKYGMLARLAVEAGFDWVFYESRSHIHCSVKT",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0007267",
                "name": "cell-cell signaling",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0007275",
                "name": "multicellular organism development",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5bd97e6d42f23684aae4b41476b217cda3882747",
        "counters": {
            "domain_architectures": 1368,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1368
        }
    }
}