"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AA50UXM4"	"{'domain_architectures': 1368, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 1368}"	"['The C-terminal part of the hedgehog protein precursor displays an autoproteolysis activity that results in the cleavage of the full-length protein into two parts (N-product and C-product). In addition, the C-terminal part displays a cholesterol transferase activity that results by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product. Once cleaved, the C-product has no signaling activity and diffuses from the cell']"	""	"[{'identifier': 'GO:0007267', 'name': 'cell-cell signaling', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0007275', 'name': 'multicellular organism development', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0AA50UXM4_9NEOP"	"5bd97e6d42f23684aae4b41476b217cda3882747"	True	False	True	87	"Protein hedgehog"	3	""	"QRCKEKLNTLAISVMNQWPGVRLRVIEGWDEENSHQDQLHYEGRAVDVTTSDRDRSKYGMLARLAVEAGFDWVFYESRSHIHCSVKT"	"unreviewed"	"{'taxId': '2201707', 'scientificName': 'Cupitha purreea', 'fullName': 'Cupitha purreea'}"