GET /api/protein/UniProt/A0AA35X2A1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AA35X2A1",
"id": "A0AA35X2A1_GEOBA",
"source_organism": {
"taxId": "519541",
"scientificName": "Geodia barretti",
"fullName": "Geodia barretti (Barrett's horny sponge)"
},
"name": "Alanine--glyoxylate aminotransferase 2, mitochondrial",
"description": [
"Multifunctional aminotransferase with a broad substrate specificity. Catalyzes the conversion of glyoxylate to glycine using alanine as the amino donor. Catalyzes metabolism of not L- but the D-isomer of D-beta-aminoisobutyric acid to generate 2-methyl-3-oxopropanoate and alanine. Catalyzes the transfer of the amino group from beta-alanine to pyruvate to yield L-alanine and 3-oxopropanoate. Can metabolize NG-monomethyl-L-arginine (NMMA), asymmetric NG,NG-dimethyl-L-arginine (ADMA) and symmetric NG,N'G-dimethyl-L-arginine (SDMA). ADMA is a potent inhibitor of nitric-oxide (NO) synthase, and this activity provides mechanism through which the kidney regulates blood pressure"
],
"length": 273,
"sequence": "MIYDVEGREYVVLDFFGGIVTISVGHCNDKVVAAIQEQTRKVQHTSTLYPNEPHVRLAEKLAAITPGALKQSFFTNSGTEANETAVLVAQLYTRSQDVIALRHGYSGRSQLAMSLTGHYTWRLNPTASPNIHHIPNAYCYRCPFGLTYPSCDLKCAKDLEGAIQTATSGRIAAFIAEPIQGVGGFITPPKEYFREVADIVHKYGGLFICDEVQTAWGRTGGKMFGIEQWDVEPDIMTFAKGMANGVPSEAPSPGRRSPTASRDCPSPPSAAIR",
"proteome": "UP001174909",
"gene": "GBAR_LOCUS23665",
"go_terms": [
{
"identifier": "GO:0030170",
"name": "pyridoxal phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "77cca87d6dced57500d02f1f72b680f70c660080",
"counters": {
"domain_architectures": 185394,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 2,
"cdd": 1,
"ssf": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 185394
}
}
}