"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AA35X2A1"	"{'domain_architectures': 185394, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 2, 'cdd': 1, 'ssf': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 185394}"	"[""Multifunctional aminotransferase with a broad substrate specificity. Catalyzes the conversion of glyoxylate to glycine using alanine as the amino donor. Catalyzes metabolism of not L- but the D-isomer of D-beta-aminoisobutyric acid to generate 2-methyl-3-oxopropanoate and alanine. Catalyzes the transfer of the amino group from beta-alanine to pyruvate to yield L-alanine and 3-oxopropanoate. Can metabolize NG-monomethyl-L-arginine (NMMA), asymmetric NG,NG-dimethyl-L-arginine (ADMA) and symmetric NG,N'G-dimethyl-L-arginine (SDMA). ADMA is a potent inhibitor of nitric-oxide (NO) synthase, and this activity provides mechanism through which the kidney regulates blood pressure""]"	"GBAR_LOCUS23665"	"[{'identifier': 'GO:0030170', 'name': 'pyridoxal phosphate binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0AA35X2A1_GEOBA"	"77cca87d6dced57500d02f1f72b680f70c660080"	True	False	False	273	"Alanine--glyoxylate aminotransferase 2, mitochondrial"	3	"UP001174909"	"MIYDVEGREYVVLDFFGGIVTISVGHCNDKVVAAIQEQTRKVQHTSTLYPNEPHVRLAEKLAAITPGALKQSFFTNSGTEANETAVLVAQLYTRSQDVIALRHGYSGRSQLAMSLTGHYTWRLNPTASPNIHHIPNAYCYRCPFGLTYPSCDLKCAKDLEGAIQTATSGRIAAFIAEPIQGVGGFITPPKEYFREVADIVHKYGGLFICDEVQTAWGRTGGKMFGIEQWDVEPDIMTFAKGMANGVPSEAPSPGRRSPTASRDCPSPPSAAIR"	"unreviewed"	"{'taxId': '519541', 'scientificName': 'Geodia barretti', 'fullName': ""Geodia barretti (Barrett's horny sponge)""}"
