GET /api/protein/UniProt/A0A9Y4NAS2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9Y4NAS2",
"id": "A0A9Y4NAS2_9TELE",
"source_organism": {
"taxId": "144197",
"scientificName": "Stegastes partitus",
"fullName": "Stegastes partitus (bicolor damselfish)"
},
"name": "LIM and SH3 domain protein 1",
"description": [
"Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types"
],
"length": 229,
"sequence": "MNPPCGRCNKPVYPTEKINCLDKYWHKGCFSCEVCKMALSMNNYKGFEKKPYCSMHYPKTSFTIVTDTPENLRLKQQSMLNSQALYKEDFERNKGKGFSVVADTPEMQRVKKTQDQISHIKYHEEFEKSKVRSDAPPPENRQDYEEQPSNPGRFSQPAGQVRPAAVAPPGGGKRYQAMYSYVAAEADEVSLQEGDLILDVEPIDEGWVFGCNQRTGQRGMLPANYVRPV",
"proteome": "UP000694891",
"gene": "LOC103364391",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "76c8d9acde580f65ff57d4926327dff9d7e80014",
"counters": {
"domain_architectures": 1027,
"entries": 23,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"profile": 3,
"smart": 3,
"cdd": 2,
"pfam": 3,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1027
}
}
}