"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A9Y4NAS2"	"{'domain_architectures': 1027, 'entries': 23, 'isoforms': 0, 'proteomes': 1, 'sets': 4, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'profile': 3, 'smart': 3, 'cdd': 2, 'pfam': 3, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1027}"	"['Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types']"	"LOC103364391"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A9Y4NAS2_9TELE"	"76c8d9acde580f65ff57d4926327dff9d7e80014"	True	False	False	229	"LIM and SH3 domain protein 1"	4	"UP000694891"	"MNPPCGRCNKPVYPTEKINCLDKYWHKGCFSCEVCKMALSMNNYKGFEKKPYCSMHYPKTSFTIVTDTPENLRLKQQSMLNSQALYKEDFERNKGKGFSVVADTPEMQRVKKTQDQISHIKYHEEFEKSKVRSDAPPPENRQDYEEQPSNPGRFSQPAGQVRPAAVAPPGGGKRYQAMYSYVAAEADEVSLQEGDLILDVEPIDEGWVFGCNQRTGQRGMLPANYVRPV"	"unreviewed"	"{'taxId': '144197', 'scientificName': 'Stegastes partitus', 'fullName': 'Stegastes partitus (bicolor damselfish)'}"
