GET /api/protein/UniProt/A0A9X9M5J7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9X9M5J7",
        "id": "A0A9X9M5J7_GULGU",
        "source_organism": {
            "taxId": "48420",
            "scientificName": "Gulo gulo",
            "fullName": "Gulo gulo (Wolverine)"
        },
        "name": "Malate dehydrogenase",
        "description": [
            "Catalyzes the reduction of aromatic alpha-keto acids in the presence of NADH. Plays essential roles in the malate-aspartate shuttle and the tricarboxylic acid cycle, important in mitochondrial NADH supply for oxidative phosphorylation. Catalyzes the reduction of 2-oxoglutarate to 2-hydroxyglutarate, leading to elevated reactive oxygen species (ROS)"
        ],
        "length": 334,
        "sequence": "MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALEKYAKKSVKVIVVGNPANTNCLTAAKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVSHAKVKLQGKEVGVYDALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGVPDDLLYSFPVTIKNKTWKIVEGLTINDFSREKMDLTAKELAEEKETAFEFLSSA",
        "proteome": "UP000269945",
        "gene": "BN2614_LOCUS3",
        "go_terms": [
            {
                "identifier": "GO:0030060",
                "name": "L-malate dehydrogenase (NAD+) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006108",
                "name": "malate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016616",
                "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016615",
                "name": "malate dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019752",
                "name": "carboxylic acid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "efa9ddffcabca3280ae0d7a3462c2f8e6d373a42",
        "counters": {
            "domain_architectures": 58034,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "pfam": 2,
                "ncbifam": 3,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 58034
        }
    }
}