GET /api/protein/UniProt/A0A9W2WHL3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9W2WHL3",
        "id": "A0A9W2WHL3_PHYMC",
        "source_organism": {
            "taxId": "9755",
            "scientificName": "Physeter macrocephalus",
            "fullName": "Physeter macrocephalus (Sperm whale)"
        },
        "name": "Post-GPI attachment to proteins factor 3",
        "description": [
            "Involved in the fatty acid remodeling steps of GPI-anchor maturation where the unsaturated acyl chain at sn-2 of inositol phosphate is replaced by a saturated stearoyl chain. May catalyze the first step of the fatty acid remodeling, by removing the unsaturated acyl chain at sn-2 of inositol phosphate, generating a lyso-GPI intermediate. The fatty acid remodeling steps is critical for the integration of GPI-APs into lipid rafts",
            "Involved in the lipid remodeling steps of GPI-anchor maturation"
        ],
        "length": 353,
        "sequence": "MAGRMVRLVLLVGAAALASGSQGDREPVYRDCVLRCEERNCSGGALKHFRSRQPIYMTLAGWTCQDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFFRFLCFQEPASAVASFLNGLASLVMLCRYRISVPASSPMYPTCVAFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSVYLCCVRTVGLQRPAVASAFRALLLLMLTAHVSYLSLVRFDYGYNLAANVAIGLVNAAWWLTWCLRNRQRLPHVRKCIVVVLLLQGLSLLELLDFPPLFWVLDAHAIWHVSTIPVHVLFFSILNLDMEGVGPESCNPPTPLLTPTWPSQVLASVQTWPHNIWGWKMGNPSGPWS",
        "proteome": "UP000248484",
        "gene": "PGAP3",
        "go_terms": [
            {
                "identifier": "GO:0006506",
                "name": "GPI anchor biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8bc368b735218ff88f96cc142c59c3cd5c167f5e",
        "counters": {
            "domain_architectures": 5090,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5090
        }
    }
}