"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A9W2WHL3"	"{'domain_architectures': 4454, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4454}"	"['Involved in the fatty acid remodeling steps of GPI-anchor maturation where the unsaturated acyl chain at sn-2 of inositol phosphate is replaced by a saturated stearoyl chain. May catalyze the first step of the fatty acid remodeling, by removing the unsaturated acyl chain at sn-2 of inositol phosphate, generating a lyso-GPI intermediate. The fatty acid remodeling steps is critical for the integration of GPI-APs into lipid rafts', 'Involved in the lipid remodeling steps of GPI-anchor maturation']"	"PGAP3"	"[{'identifier': 'GO:0006506', 'name': 'GPI anchor biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A9W2WHL3_PHYMC"	"8bc368b735218ff88f96cc142c59c3cd5c167f5e"	True	False	353	"Post-GPI attachment to proteins factor 3"	3	"UP000248484"	"MAGRMVRLVLLVGAAALASGSQGDREPVYRDCVLRCEERNCSGGALKHFRSRQPIYMTLAGWTCQDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFFRFLCFQEPASAVASFLNGLASLVMLCRYRISVPASSPMYPTCVAFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSVYLCCVRTVGLQRPAVASAFRALLLLMLTAHVSYLSLVRFDYGYNLAANVAIGLVNAAWWLTWCLRNRQRLPHVRKCIVVVLLLQGLSLLELLDFPPLFWVLDAHAIWHVSTIPVHVLFFSILNLDMEGVGPESCNPPTPLLTPTWPSQVLASVQTWPHNIWGWKMGNPSGPWS"	"unreviewed"	"{'taxId': '9755', 'scientificName': 'Physeter macrocephalus', 'fullName': 'Physeter macrocephalus (Sperm whale)'}"