General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9W2UK97",
        "id": "A0A9W2UK97_PANPR",
        "source_organism": {
            "taxId": "9691",
            "scientificName": "Panthera pardus",
            "fullName": "Panthera pardus (Leopard)"
        },
        "name": "Probable cytosolic iron-sulfur protein assembly protein CIAO1",
        "description": [
            "Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins. As a CIA complex component, interacts specifically with CIAO2A or CIAO2B and MMS19 to assist different branches of iron-sulfur protein assembly, depending of its interactors. The complex CIAO1:CIAO2B:MMS19 binds to and facilitates the assembly of most cytosolic-nuclear Fe/S proteins. CIAO1:CIAO2A specifically matures ACO1 and stabilizes IREB2. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation",
            "Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation"
        ],
        "length": 339,
        "sequence": "MKDSLVLLARVPAHPDSRCWFLAWNPAGTLLASCGGDRRVRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCYATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPNNEQGVACSGSDPSWKCICTLSGFHSRTIYDVAWCQLTGALATACGDDAIRVFEEDPSSDPQQPTFSLTAHLPQAHSQDVNCVAWNPKEQGLLASCSDDGEVAFWKYQRPEGI",
        "proteome": "UP001165780",
        "gene": "CIAO1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016226",
                "name": "iron-sulfur cluster assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0097361",
                "name": "cytosolic [4Fe-4S] assembly targeting complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "87f0491a909b57bb621cadc1b0f405a1de582499",
        "counters": {
            "domain_architectures": 21012,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 3,
                "cathgene3d": 1,
                "smart": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21012
        }
    }
}