GET /api/protein/UniProt/A0A9J7FYC8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9J7FYC8",
        "id": "A0A9J7FYC8_CRIGR",
        "source_organism": {
            "taxId": "10029",
            "scientificName": "Cricetulus griseus",
            "fullName": "Cricetulus griseus (Chinese hamster)"
        },
        "name": "N-lysine methyltransferase KMT5A",
        "description": [
            "Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins. Specifically monomethylates 'Lys-20' of histone H4 (H4K20me1). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression. Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. Required for cell proliferation, probably by contributing to the maintenance of proper higher-order structure of DNA during mitosis. Involved in chromosome condensation and proper cytokinesis. Nucleosomes are preferred as substrate compared to free histones. Mediates monomethylation of p53/TP53 at 'Lys-382', leading to repress p53/TP53-target genes. Plays a negative role in TGF-beta response regulation and a positive role in cell migration"
        ],
        "length": 345,
        "sequence": "MCKPRAVEAAAAAVAAATAPGPEMVEQRGPGRPRSDGENVFAGQSKIYAYMSPNKCSGMRSPLQEENSVAHHEVKCQGKPLAGIYKKREEKRNGGSTIRSSVKSDEQKIKDARRGPLAPFPNQKSEAAEPPKTPPQSCDPTNTVVAKQALKKPLKGKQAPRKKSQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKKIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH",
        "proteome": "UP001108280",
        "gene": "Kmt5a",
        "go_terms": [
            {
                "identifier": "GO:0042799",
                "name": "histone H4K20 methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "df0349b27ec7a00aa89fcc9259babadd08257a80",
        "counters": {
            "domain_architectures": 58303,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cathgene3d": 1,
                "cdd": 1,
                "smart": 1,
                "ssf": 1,
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 58303
        }
    }
}