General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9F2QWB6",
        "id": "A0A9F2QWB6_PYTBI",
        "source_organism": {
            "taxId": "176946",
            "scientificName": "Python bivittatus",
            "fullName": "Python bivittatus (Burmese python)"
        },
        "name": "E3 ubiquitin-protein ligase E3D",
        "description": [
            "E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome. Independently of its E3 ubiquitin-protein ligase activity, acts as an inhibitor of CPSF3 endonuclease activity by blocking CPSF3 active site"
        ],
        "length": 385,
        "sequence": "MEATLFLEIRERMQSGSLIIRELHPESWPVDIAVMPSLVELKSGKACKAFSLPPGVAIVPSSCRGLQYLPGEGLHLRLLVQVDFSAKLMPAVGDGLKSKKSCTFYCQSCGESVINNRTFLRVLSLPFENWNDLVEEWCCHPNPFNDSLLHPQNDDCFLGHNYLMINSRSELSGTESGILYSEDEWATSCESPSNSQANSTVICKRCKTLLGEAMPSGVIKYYFTELLVQPSEDSFHVIPRSSFIRSVIARCFMELAFSRSTFRFSIQGMDGTVYILIWILNCDTLMVETSGNPASNNVFTLLEPELSSSLRPAEIHKAVKVLYHPCTENRNKDLVDSWGEDIGVSSLTFPSKTCLELLLILSQSNASLPPSLRWMNSFQVAFLKL",
        "proteome": "UP000695026",
        "gene": "UBE3D",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b9b613a3502898c2e8f146ca4f1002d6a7ee4c1a",
        "counters": {
            "domain_architectures": 3753,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3753
        }
    }
}