General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9D3RYS3",
        "id": "A0A9D3RYS3_ANGAN",
        "source_organism": {
            "taxId": "7936",
            "scientificName": "Anguilla anguilla",
            "fullName": "Anguilla anguilla (European freshwater eel)"
        },
        "name": "Major facilitator superfamily domain containing 2B",
        "description": [
            "Sodium-dependent lysophosphatidylcholine (LPC) symporter, which plays an essential role for blood-brain barrier formation and function. Specifically expressed in endothelium of the blood-brain barrier of micro-vessels and transports LPC into the brain. Transport of LPC is essential because it constitutes the major mechanism by which docosahexaenoic acid (DHA), an omega-3 fatty acid that is essential for normal brain growth and cognitive function, enters the brain. Transports LPC carrying long-chain fatty acids such LPC oleate and LPC palmitate with a minimum acyl chain length of 14 carbons. Does not transport docosahexaenoic acid in unesterified fatty acid"
        ],
        "length": 523,
        "sequence": "MAKREKLACGSSDQLLNPAEPHFSKPLQQTEERLTICSKICFAIGGAPSQIAGSATAFFLQIYLLDVAQINPFHASVVLFVGKAWGAAMDPLVGFFITKSKWTRIGRLMPWMVGCTPFVVISYFYLWYVPPFSSGKFVWYLSFYCLYQTLIACFHVPYSALTMFLSANQKERDSATAYRMTMEVLGTLVGAAVQGQIVASAHTRNHCSAHNLTATPLENNGSAHITPVTDFLSHAKEMYMIAAGVIGGIFLLCTLVMFLGVKEKDDPYARSTGKPIPFHKGFLLVMRHWPYLTLTAAFLFIGVAIQLVQSNFVLFCTYAVDLRDHFHYIVLIILISAAVSIPLWQWFLGRFGKKTAAYCGITWMVPFTILLVCFPNLVVAYVVAVASGLSIAASMLLPWSMLPDVVDDFRRANPDSRGHEAIFYSFYVFFTKFASGISLGVSMLSLQFAGYKTRHCQQPEPVVYTLKLLMGAAPVAFILIGLAILLFYPITEEVRQKNKLSLDQLREQGLGTGSEAEDLRGEV",
        "proteome": "UP001044222",
        "gene": "ANANG_G00114210",
        "go_terms": [
            {
                "identifier": "GO:0015293",
                "name": "symporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008643",
                "name": "carbohydrate transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "18700fec056a4a6b8afdaf19377d37db5df6a411",
        "counters": {
            "domain_architectures": 42036,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 42036
        }
    }
}