GET /api/protein/UniProt/A0A9C6YPL3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A9C6YPL3",
"id": "A0A9C6YPL3_HEMSP",
"source_organism": {
"taxId": "29711",
"scientificName": "Hemerocallis sp.",
"fullName": "Hemerocallis sp. (Daylily)"
},
"name": "Expansin",
"description": [
"Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found"
],
"length": 132,
"sequence": "NPPLQHFDLSQPVFQQIAQYRAGIVPVAYKRVQCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHVVAIKGSRTGWHAMSRNWGQNWQSNANLNGQTLSFKVITSDGRSIVSYNVAPASWTFGQTFSGGQFR",
"proteome": null,
"gene": "EXP5",
"go_terms": [
{
"identifier": "GO:0009664",
"name": "plant-type cell wall organization",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c97f4db8fee7db10ec81bb72b2815f6051c5b340",
"counters": {
"domain_architectures": 18404,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 2,
"pfam": 2,
"ssf": 2,
"panther": 1,
"prints": 2,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 18404
}
}
}