GET /api/protein/UniProt/A0A9C6YPL3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9C6YPL3",
        "id": "A0A9C6YPL3_HEMSP",
        "source_organism": {
            "taxId": "29711",
            "scientificName": "Hemerocallis sp.",
            "fullName": "Hemerocallis sp. (Daylily)"
        },
        "name": "Expansin",
        "description": [
            "Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found"
        ],
        "length": 132,
        "sequence": "NPPLQHFDLSQPVFQQIAQYRAGIVPVAYKRVQCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHVVAIKGSRTGWHAMSRNWGQNWQSNANLNGQTLSFKVITSDGRSIVSYNVAPASWTFGQTFSGGQFR",
        "proteome": null,
        "gene": "EXP5",
        "go_terms": [
            {
                "identifier": "GO:0009664",
                "name": "plant-type cell wall organization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c97f4db8fee7db10ec81bb72b2815f6051c5b340",
        "counters": {
            "domain_architectures": 18404,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 2,
                "pfam": 2,
                "ssf": 2,
                "panther": 1,
                "prints": 2,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 18404
        }
    }
}