"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A9C6YPL3"	"{'domain_architectures': 18404, 'entries': 18, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'profile': 2, 'pfam': 2, 'ssf': 2, 'panther': 1, 'prints': 2, 'interpro': 7}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 18404}"	"['Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found']"	"EXP5"	"[{'identifier': 'GO:0009664', 'name': 'plant-type cell wall organization', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A9C6YPL3_HEMSP"	"c97f4db8fee7db10ec81bb72b2815f6051c5b340"	True	False	True	132	"Expansin"	2	""	"NPPLQHFDLSQPVFQQIAQYRAGIVPVAYKRVQCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHVVAIKGSRTGWHAMSRNWGQNWQSNANLNGQTLSFKVITSDGRSIVSYNVAPASWTFGQTFSGGQFR"	"unreviewed"	"{'taxId': '29711', 'scientificName': 'Hemerocallis sp.', 'fullName': 'Hemerocallis sp. (Daylily)'}"