General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9B0TKW5",
        "id": "A0A9B0TKW5_CHRAS",
        "source_organism": {
            "taxId": "185453",
            "scientificName": "Chrysochloris asiatica",
            "fullName": "Chrysochloris asiatica (Cape golden mole)"
        },
        "name": "Alkyl transferase",
        "description": [
            "With NUS1, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Both subunits contribute to enzymatic activity, i.e. condensation of multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol phosphate which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Synthesizes long-chain polyprenols, mostly of C95 and C100 chain length. Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol"
        ],
        "length": 294,
        "sequence": "MSWIKEGELSLWERFCANILKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKNEVDGLMDLARQKFNRLMEEQCFLNVCFAYTSRHEISNAVKEMAWGVEQGLLEPSDISESLIDKCLYTNHSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNFCEAILQFQMNHSVLQKARDMYAEERKRQQLERDQAAVTKQLLQEGLQASGDAQLRRTCLHKLSARREERVQGFLQALELKRADWLARLGTASA",
        "proteome": "UP000504623",
        "gene": "DHDDS",
        "go_terms": [
            {
                "identifier": "GO:0016765",
                "name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8876159cda9be3aef4959c6d968051615c4cbfab",
        "counters": {
            "domain_architectures": 1401,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1401
        }
    }
}