GET /api/protein/UniProt/A0A974HVP1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A974HVP1",
        "id": "A0A974HVP1_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "SAM pointed domain-containing Ets transcription factor",
        "description": [
            "May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a transcriptional activator for SERPINB5 promoter"
        ],
        "length": 317,
        "sequence": "MGSNSANLPSVTHSRLALQDSTLTSLDKASDEGAPGYYLPFCDMLYAGEGGSWAPKGLMQVVHRGEGTKEPEQCPVIDSQGLHHELEYQTSLHLEDHSLEQMQTMVVGEVLKDIETACKLLNISADPMEWSAGNVQKWILWTEHQYRLPQVGRSFQELTGKDLCALSEENFRERSPLCGDVLYAHLDIWKSAAWMKEKTGPGELRYCGGSGVVGECWADTEVDSSGSGQPIHLWQFLKELLLKPHSYGRSIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDVSQRLVYQFVHPL",
        "proteome": null,
        "gene": "spdef.S",
        "go_terms": [
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006357",
                "name": "regulation of transcription by RNA polymerase II",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "522927238307a85066168b858327df5283cc4088",
        "counters": {
            "domain_architectures": 10817,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "profile": 2,
                "smart": 2,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 10817
        }
    }
}