General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A974DI55",
        "id": "A0A974DI55_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Cytochrome c oxidase copper chaperone",
        "description": [
            "Copper metallochaperone essential for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Binds two copper ions and delivers them to the metallochaperone SCO1 which transports the copper ions to the Cu(A) site on the cytochrome c oxidase subunit II (MT-CO2/COX2)"
        ],
        "length": 65,
        "sequence": "MSSLAAASCESQSSESQEKKPLKPCCACPETKKARDACIIEKGEENCQHLIEAHKECMRSLGFKV",
        "proteome": null,
        "gene": "cox17.S",
        "go_terms": [
            {
                "identifier": "GO:0005507",
                "name": "copper ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016531",
                "name": "copper chaperone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005758",
                "name": "mitochondrial intermembrane space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1433098304dfcb6ac91510bff5aaf918490d03e2",
        "counters": {
            "domain_architectures": 3451,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3451
        }
    }
}