"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A974DI55"	"{'domain_architectures': 3451, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3451}"	"['Copper metallochaperone essential for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Binds two copper ions and delivers them to the metallochaperone SCO1 which transports the copper ions to the Cu(A) site on the cytochrome c oxidase subunit II (MT-CO2/COX2)']"	"cox17.S"	"[{'identifier': 'GO:0005507', 'name': 'copper ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016531', 'name': 'copper chaperone activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005758', 'name': 'mitochondrial intermembrane space', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A974DI55_XENLA"	"1433098304dfcb6ac91510bff5aaf918490d03e2"	True	False	False	65	"Cytochrome c oxidase copper chaperone"	3	""	"MSSLAAASCESQSSESQEKKPLKPCCACPETKKARDACIIEKGEENCQHLIEAHKECMRSLGFKV"	"unreviewed"	"{'taxId': '8355', 'scientificName': 'Xenopus laevis', 'fullName': 'Xenopus laevis (African clawed frog)'}"