GET /api/protein/UniProt/A0A974CDL0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A974CDL0",
"id": "A0A974CDL0_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "CWH43-like N-terminal domain-containing protein",
"description": [
"Modulator of macroautophagy that causes accumulation of autophagosomes under basal conditions and enhances autophagic flux. Represses cell death and promotes long-term clonogenic survival of cells grown in the absence of glucose in a macroautophagy-independent manner. May have some role in extracellular matrix engulfment or growth factor receptor recycling, both of which can modulate cell survival"
],
"length": 230,
"sequence": "MWAWALLPICLTIWATAGIWIVYGMSVSNGSVNLSDGFPYISLCGTDPPQSCVFGQVLNVGAMLGVWISAIRFQQIRDYNCHSVLNSVSLAMGILCALGTSIVGNFQQSNQLETHLAGAFLAFVIGNIYFWMQTALTYMVKPTHGGCYIGPIRFCLSVACTALIVLMAVFLKMNMKSISAICEWIVAMILFLLYGLFAVDFWHLDGHYFHVKKRTVIPNEMQVSTVTLSI",
"proteome": null,
"gene": "tmem150b.S",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ab18c14a05b6d083e3b0fef65d3721398aa0f31f",
"counters": {
"domain_architectures": 12942,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 12942
}
}
}